Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P10828
RecName: Thyroid hormone receptor beta
Begin-End: 105-176
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
ELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQEC
RFKKCIYVGMAT
Structures of the domain P10828 105-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nll X-ray 1.9 B 301-372  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text