Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P10964
RecName: DNA-directed RNA polymerase I subunit RPA190
Begin-End: 989-1611
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQF
MYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKH
SKEPHYKQSVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRA
LMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMT
ASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSNTAGGNAAR
SYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAV
PRLQTDVANSSSNSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGID
SDKESDSDSEDEDVDMNEQINKSIVEANNNMNKVQRDRQSAIISHHRFITKYNFDDESGK
WCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLVTEGVNFQA
MWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADM
MTRQGTYLAFNRQGMETSTSSFM
Structures of the domain P10964 989-1611
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m5x X-ray 4 A 989-1611 None
6tps X-ray 3.54 A 989-1611 None
5m64 X-ray 4.6 A 989-1611 None
5w5y X-ray 3.8 A 989-1611  H-Bb 
6ruo X-ray 3.5 A 989-1611 None
6rrd X-ray 3.1 A 989-1611  L-Bb 
6rql X-ray 2.9 A 989-1611 None
5n61 X-ray 3.4 A 989-1611 None
5m5w X-ray 3.8 A 989-1611 None
5m5y X-ray 4 A 989-1611  H-Bb 
5m3f X-ray 3.8 A 989-1611 None
6h67 X-ray 3.6 A 989-1611  L-Bb 
5w66 X-ray 3.9 A 989-1611 None
5w65 X-ray 4.3 A 989-1611  H-Bb 
5oa1 X-ray 4.4 A 989-1611 None
6hko X-ray 3.42 A 989-1611  H-Bb 
6rqt X-ray 4 A 989-1611 None
6h68 X-ray 4.6 A 989-1611  L-Bb 
6rqh X-ray 3.7 A 989-1611 None
6rwe X-ray 3 A 989-1611 None
6hlq X-ray 3.18 A 989-1611  H-Bb 
6rui X-ray 2.7 A 989-1611 None
6hlr X-ray 3.18 A 989-1611  H-Bb 
5w64 X-ray 4.2 A 989-1611  H-Bb 


© NPIDB team 2003 - 2021

text