Pfam domain
Pfam family: Ets (PF00178.24)
Uniprot AC: P11308
RecName: Transcriptional regulator ERG
Begin-End: 312-391
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
NPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDK
LSRALRYYYDKNIMTKVHGK
Structures of the domain P11308 312-391
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ybd X-ray 2.77 X 312-391  H-Bb H-Mj S-Bb L-Bb 
5ybd X-ray 2.77 A 312-391  H-Bb H-Mj S-Bb L-Bb 
4iri X-ray 2.77 A 295-374  H-Bb H-Mj L-Bb 
6vgg X-ray 4.31 A 312-391  H-Bb H-Mj S-Bb L-Bb 
6vge X-ray 4.25 A 312-391  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text