Pfam domain
Pfam family: Topoisom_I (PF01028.22)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 432-635
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj 

Sequence:
SSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGN
EKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNL
QLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDEN
IPAKILSYNRANRAVAILCNHQRA
Structures of the domain P11387 432-635
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1k4s X-ray 3.2 A 432-725  H-Bb L-Bb 
1ej9 X-ray 2.6 A 432-724  H-Bb H-Mj H-Mn L-Bb L-Mj 
1rr8 X-ray 2.6 C 432-725  H-Bb H-Mn L-Bb 
1a35 X-ray 2.5 A 432-729  H-Bb H-Mj H-Mn L-Bb L-Mj 


© NPIDB team 2003 - 2021

text