Pfam domain
Pfam family: Topo_C_assoc (PF14370.8)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 713-765
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
QIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Structures of the domain P11387 713-765
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ej9 X-ray 2.6 A 628-765  H-Bb H-Mj L-Bb 
1a35 X-ray 2.5 A 625-765  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text