Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: P11632
RecName: Non-histone chromosomal protein 6A
Begin-End: 21-89
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKR
YESEKELYN
Structures of the domain P11632 21-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j5n NMR A 21-89  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text