Pfam domain
Pfam family: SRF-TF (PF00319.20)
Uniprot AC: P11831
RecName: Serum response factor
Begin-End: 150-197
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTF
Structures of the domain P11831 150-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1srs X-ray 3.2 B 150-197 None
1srs X-ray 3.2 A 150-197 None
1hbx X-ray 3.15 A 150-197 None
1hbx X-ray 3.15 B 150-197 None
1hbx X-ray 3.15 E 150-197 None
1hbx X-ray 3.15 D 150-197 None
1k6o X-ray 3.19 C 150-197  H-Bb H-Mj 
1k6o X-ray 3.19 B 150-197  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text