Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: P11938
RecName: DNA-binding protein RAP1
Begin-End: 360-411
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYL
Structures of the domain P11938 360-411
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gfb X-ray 2.99 A 360-411  H-Bb H-Mj L-Bb L-Mj L-Mn 
1ign X-ray 2.25 A 360-411  H-Bb H-Mj L-Bb L-Mj L-Mn 
1ign X-ray 2.25 B 360-411  H-Bb H-Mj L-Bb L-Mj L-Mn 
3ukg X-ray 2.95 A 360-411  H-Bb H-Mj L-Bb L-Mn 
6ldm X-ray 2.4 A 361-411 None


© NPIDB team 2003 - 2021

text