Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 1372-1406
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:   

Sequence:
VYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKV
Structures of the domain P12497 1372-1406
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6puw X-ray 2.9 B 239-259 None


© NPIDB team 2003 - 2021

text