Pfam domain
Pfam family: IMS (PF00817.22)
Uniprot AC: P12689
RecName: DNA repair protein REV1
Begin-End: 361-522
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
IDFDCFFATVAYLCRSSSFSACDFKRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQ
AEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPISIDEAVCVRIIPDNIH
NTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALK
Structures of the domain P12689 361-522
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2aq4 X-ray 2.32 A 361-522 None
5wm8 X-ray 1.92 A 361-522  H-Bb S-Bb 
6x70 X-ray 2.05 A 361-522  H-Bb S-Bb L-Bb 
3bjy X-ray 2.41 A 361-522 None
3osp X-ray 2.5 A 361-522 None
5wm1 X-ray 1.85 A 361-522  H-Bb S-Bb 
5wmb X-ray 2.25 A 361-522  H-Bb S-Bb 
6x75 X-ray 1.95 A 361-522  H-Bb S-Bb 
6x72 X-ray 2.19 A 361-522 None
6x77 X-ray 1.64 A 361-522  S-Bb 
6x76 X-ray 2.53 A 361-522  H-Bb S-Bb 
6x71 X-ray 1.78 A 361-522  H-Bb S-Bb 
6x73 X-ray 2.05 A 361-522  H-Bb S-Bb 
6x6z X-ray 1.4 A 361-522  H-Bb S-Bb 
6x74 X-ray 1.69 A 361-522  H-Bb S-Bb 


© NPIDB team 2003 - 2021

text