Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: P12689
RecName: DNA repair protein REV1
Begin-End: 620-738
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb 

Sequence:
RKSLSIDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEP
PKYMGMGRCDSFSRSSRLGIPTNEFGIIATEMKSLYRTLGCPPMELRGLALQFNKLVDV
Structures of the domain P12689 620-738
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2aq4 X-ray 2.32 A 620-738  S-Bb S-Mj L-Bb 
5wm8 X-ray 1.92 A 620-738  S-Bb S-Mj L-Bb 
3bjy X-ray 2.41 A 620-738  H-Bb S-Bb S-Mj L-Bb 
3osp X-ray 2.5 A 620-738  S-Bb S-Mj L-Bb 
5wm1 X-ray 1.85 A 620-738  H-Bb S-Bb S-Mj L-Bb 
5wmb X-ray 2.25 A 620-738  H-Bb S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text