Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: P12689
RecName: DNA repair protein REV1
Begin-End: 620-744
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb 

Sequence:
RKSLSIDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEP
PKYMGMGRCDSFSRSSRLGIPTNEFGIIATEMKSLYRTLGCPPMELRGLALQFNKLVDVG
PDNNQ
Structures of the domain P12689 620-744
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6x70 X-ray 2.05 A 620-743  H-Bb S-Bb S-Mj L-Bb 
6x75 X-ray 1.95 A 620-744  H-Bb S-Bb S-Mj L-Bb 
6x72 X-ray 2.19 A 620-744  S-Bb S-Mj L-Bb 
6x77 X-ray 1.64 A 620-745  H-Bb S-Bb S-Mj L-Bb 
6x76 X-ray 2.53 A 620-744  S-Bb S-Mj L-Bb 
6x71 X-ray 1.78 A 620-744  H-Bb S-Bb S-Mj L-Bb 
6x73 X-ray 2.05 A 620-745  H-Bb S-Bb S-Mj L-Bb 
6x6z X-ray 1.4 A 620-744  H-Bb S-Bb S-Mj L-Bb 
6x74 X-ray 1.69 A 620-745  H-Bb S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text