Pfam domain
Pfam family: Ku (PF02735.18)
Uniprot AC: P12956
RecName: X-ray repair cross-complementing protein 6
Begin-End: 263-468
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb 

Sequence:
LNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIY
GSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLF
SALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADD
KRKMPFTEKIMATPEQVGKMKAIVEK
Structures of the domain P12956 263-468
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zhe X-ray 7.24 G 265-451  L-Mn 
6zhe X-ray 7.24 B 265-451 None
1jey X-ray 2.5 A 265-451  L-Bb 
6erf X-ray 3.01 A 265-451  L-Bb L-Mj 
6erf X-ray 3.01 C 265-451  L-Bb L-Mj 
6erf X-ray 3.01 E 265-451  L-Bb L-Mj 
6erf X-ray 3.01 G 265-451  L-Bb L-Mj 
6erg X-ray 2.9 A 265-451  S-Bb L-Bb 
6erg X-ray 2.9 D 265-451  S-Bb L-Bb 
6erh X-ray 2.8 A 265-451  L-Bb 
6erh X-ray 2.8 C 265-451  L-Bb 
5y3r X-ray 6.6 A 265-451  H-Bb L-Bb L-Mn 
6zha X-ray 3.91 B 265-451  L-Bb 


© NPIDB team 2003 - 2021

text