Pfam domain
Pfam family: Ku_N (PF03731.17)
Uniprot AC: P12956
RecName: X-ray repair cross-complementing protein 6
Begin-End: 37-256
Organism: Homo sapiens
Interaction Mode:  L-Bb L-Mn 

Sequence:
SLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNS
VNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSD
VQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLF
YRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRAL
Structures of the domain P12956 37-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zhe X-ray 7.24 G 37-265  S-Bb 
6zhe X-ray 7.24 B 37-265 None
1jey X-ray 2.5 A 37-256 None
6erg X-ray 2.9 A 37-256 None
6erg X-ray 2.9 D 37-256 None
6erh X-ray 2.8 A 37-256  L-Bb L-Mn 
6erh X-ray 2.8 C 37-256  L-Bb 
5y3r X-ray 6.6 A 37-256  L-Bb 
6zha X-ray 3.91 B 37-265 None
6erf X-ray 3.01 A 37-256 None
6erf X-ray 3.01 C 37-256 None
6erf X-ray 3.01 E 37-256 None
6erf X-ray 3.01 G 37-256  L-Bb 


© NPIDB team 2003 - 2021

text