Pfam domain
Pfam family: Ku_C (PF03730.16)
Uniprot AC: P12956
RecName: X-ray repair cross-complementing protein 6
Begin-End: 472-534
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYP
PDY
Structures of the domain P12956 472-534
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zhe X-ray 7.24 G 472-534 None
6zhe X-ray 7.24 B 472-534 None
1jey X-ray 2.5 A 472-534 None
6erf X-ray 3.01 A 472-535 None
6erf X-ray 3.01 C 472-535 None
6erf X-ray 3.01 E 472-535 None
6erf X-ray 3.01 G 472-534 None
6erg X-ray 2.9 A 472-534 None
6erg X-ray 2.9 D 472-534 None
6erh X-ray 2.8 A 472-534 None
6erh X-ray 2.8 C 472-534 None
5y3r X-ray 6.6 A 472-534 None
6zha X-ray 3.91 B 472-534 None


© NPIDB team 2003 - 2021

text