Pfam domain
Pfam family: Ku (PF02735.18)
Uniprot AC: P13010
RecName: X-ray repair cross-complementing protein 5
Begin-End: 253-453
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb L-Mn 

Sequence:
IGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQ
GFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEA
AAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQ
YMFSSLKNSKKYAPTEAQLNA
Structures of the domain P13010 253-453
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zhe X-ray 7.24 C 253-453  L-Bb 
6zhe X-ray 7.24 H 253-453  L-Bb 
1jey X-ray 2.5 B 253-453  S-Bb L-Bb L-Mn 
6erf X-ray 3.01 B 253-453  S-Bb L-Bb 
6erf X-ray 3.01 D 253-453  S-Bb L-Bb 
6erf X-ray 3.01 F 253-453  S-Bb L-Bb 
6erf X-ray 3.01 H 253-453  S-Bb L-Bb 
6erg X-ray 2.9 B 253-453  S-Bb L-Bb 
6erg X-ray 2.9 E 253-453  L-Bb 
6erh X-ray 2.8 B 253-453  S-Bb L-Bb 
6erh X-ray 2.8 D 253-453  L-Bb L-Mn 
5y3r X-ray 6.6 B 253-453  S-Bb L-Bb L-Mn 
6zha X-ray 3.91 C 253-453  L-Bb L-Mn 


© NPIDB team 2003 - 2021

text