Pfam domain
Pfam family: Ku_C (PF03730.16)
Uniprot AC: P13010
RecName: X-ray repair cross-complementing protein 5
Begin-End: 476-545
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
LFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKT
LFPLIEAKKK
Structures of the domain P13010 476-545
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jey X-ray 2.5 B 476-545  H-Bb 
6erg X-ray 2.9 B 476-542  H-Bb 
6erg X-ray 2.9 E 476-543  H-Bb 
6erh X-ray 2.8 B 476-542  H-Bb 
6erh X-ray 2.8 D 476-543  H-Bb 
5y3r X-ray 6.6 B 476-541  H-Bb 
6erf X-ray 3.01 B 476-542 None
6erf X-ray 3.01 D 476-542 None
6erf X-ray 3.01 F 476-542 None
6erf X-ray 3.01 H 476-542 None


© NPIDB team 2003 - 2021

text