Pfam domain
Pfam family: Ku_N (PF03731.17)
Uniprot AC: P13010
RecName: X-ray repair cross-complementing protein 5
Begin-End: 9-244
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
AVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPL
SGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFE
KRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGH
GPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHS
Structures of the domain P13010 9-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zhe X-ray 7.24 C 9-243 None
6zhe X-ray 7.24 H 9-243 None
1jey X-ray 2.5 B 9-243  L-Bb 
6erf X-ray 3.01 B 9-243 None
6erf X-ray 3.01 D 9-243 None
6erf X-ray 3.01 F 9-243 None
6erf X-ray 3.01 H 9-243 None
6erg X-ray 2.9 B 9-243  L-Bb 
6erg X-ray 2.9 E 9-243  L-Bb 
6erh X-ray 2.8 B 9-243  L-Bb 
6erh X-ray 2.8 D 9-243  L-Bb 
5y3r X-ray 6.6 B 9-243 None
6zha X-ray 3.91 C 9-243 None


© NPIDB team 2003 - 2021

text