Pfam domain
Pfam family: RNA_pol (PF00940.21)
Uniprot AC: P13433
RecName: DNA-directed RNA polymerase, mitochondrial
Begin-End: 855-1351
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KKLGPSGLKWLKIHLSNLFGFDKLPLKDRVAFTESHLQDIKDSAENPLTGDRWWTTADKP
WQALATCFELNEVMKMDNPEEFISHQPVHQDGTCNGLQHYAALGGDVEGATQVNLVPSDK
PQDVYAHVARLVQKRLEIAAEKGDENAKILKDKITRKVVKQTVMTNVYGVTYVGATFQIA
KQLSPIFDDRKESLDFSKYLTKHVFSAIRELFHSAHLIQDWLGESAKRISKSIRLDVDEK
SFKNGNKPDFMSSVIWTTPLGLPIVQPYREESKKQVETNLQTVFISDPFAVNPVNARRQK
AGLPPNFIHSLDASHMLLSAAECGKQGLDFASVHDSYWTHASDIDTMNVVLREQFIKLHE
VDLVLRLKEEFDQRYKNYVKIGKLKRSTDLAQKIIRIRKDLSRKLGRSTTLADEIYFEKK
RQELLNSPLIEDRNVGEKMVTTVSLFEDITDLDALELENGGDENSGMSVLLPLRLPEIPP
KGDFDVTVLRNSQYFFS
Structures of the domain P13433 855-1351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ymw X-ray 3.71 A 855-1351  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text