Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P13445
RecName: RNA polymerase sigma factor RpoS
Begin-End: 173-250
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEK
ALLDILADEKENGPEDTT
Structures of the domain P13445 173-250
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kj6 X-ray 3.8 F 173-250  H-Bb H-Mj 
5ipl X-ray 3.6 F 173-250 None
5ipm X-ray 4.2 F 173-250  H-Mj 
5ipn X-ray 4.61 F 173-250  H-Mj 


© NPIDB team 2003 - 2021

text