Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: P13445
RecName: RNA polymerase sigma factor RpoS
Begin-End: 262-315
Organism: Escherichia coli
Interaction Mode:   

Sequence:
WLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLRE
Structures of the domain P13445 262-315
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kj6 X-ray 3.8 F 262-315  H-Mj 
5ipl X-ray 3.6 F 262-315 None
5ipm X-ray 4.2 F 262-315 None
5ipn X-ray 4.61 F 262-315 None
6ido X-ray 3.75 A 22-75  H-Bb H-Mj L-Bb L-Mj 
6ido X-ray 3.75 B 22-75  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text