Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P13445
RecName: RNA polymerase sigma factor RpoS
Begin-End: 94-164
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQT
IERAIMNQTRT
Structures of the domain P13445 94-164
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kj6 X-ray 3.8 F 94-164  H-Bb H-Mj H-Mn 
5ipl X-ray 3.6 F 94-164  H-Bb H-Mj H-Mn 
5ipm X-ray 4.2 F 94-164  H-Bb H-Mj H-Mn 
5ipn X-ray 4.61 F 94-164  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text