Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P13788
RecName: 30S ribosomal protein S4, chloroplastic
Begin-End: 89-136
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
MRLDNILFRLGMAPTIPGARQLVNHRHILVNGRIVDIPSYRCKPQDTI
Structures of the domain P13788 89-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8r X-ray 3.7 d 89-136 None
5mmj X-ray 3.65 d 89-136 None


© NPIDB team 2003 - 2021

text