Pfam domain
Pfam family: TFIIF_beta_N (PF17683.3)
Uniprot AC: P13984
RecName: General transcription factor IIF subunit 2
Begin-End: 15-198
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPAS
VSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEE
SSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKH
QYYN
Structures of the domain P13984 15-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iyc X-ray 3.9 T 15-105 None
6o9l X-ray 7.2 T 15-107 None
5iy9 X-ray 6.3 T 15-105 None
5iyb X-ray 3.9 T 15-105 None
5iy6 X-ray 7.2 T 15-105 None
5iya X-ray 5.4 T 15-105 None
5iy8 X-ray 7.9 T 15-105 None
5iyd X-ray 3.9 T 15-105 None
5iy7 X-ray 8.6 T 15-105 None


© NPIDB team 2003 - 2021

text