Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: P14284
RecName: DNA polymerase zeta catalytic subunit
Begin-End: 616-844
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VQKWYNKVPSMGNKKTESQISMHTPHSKFLYKFASDVSGKQKRKKSSVHDSLTHLTLEIH
ANTRSDKIPDPAIDEVSMIIWCLEEETFPLDLDIAYEGIMIVHKASEDSTFPTKIQHCIN
EIPVMFYESEFEMFEALTDLVLLLDPDILSGFEIHNFSWGYIIERCQKIHQFDIVRELAR
VKCQIKTKLSDTWGYAHSSGIMITGRHMINIWRALRSDVNLTQYTIESA
Structures of the domain P14284 616-844
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6v93 X-ray 3.1 A 599-844 None


© NPIDB team 2003 - 2021

text