Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P14294
RecName: DNA topoisomerase 3
Begin-End: 2-137
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RLFIAEKPSLARAIADVLPKPHRKGDGFIECGNGQVVTWCIGHLLEQAQPDAYDSRYARW
NLADLPIVPEKWQLQPRPSVTKQLNVIKRFLHEASEIVHAGDPDREGQLLVDEVLDYLQL
APEKRQQVQRCLINDL
Structures of the domain P14294 2-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i7d X-ray 2.05 A 2-137 None
2o19 X-ray 2.45 B 2-137 None
2o19 X-ray 2.45 A 2-137 None
2o5c X-ray 2.35 B 2-137 None
2o5c X-ray 2.35 A 2-137 None
2o5e X-ray 2.5 B 2-137 None
2o5e X-ray 2.5 A 2-137 None
2o54 X-ray 2.5 B 2-137 None
2o54 X-ray 2.5 A 2-137 None
2o59 X-ray 2.5 B 2-137 None
2o59 X-ray 2.5 A 2-137 None


© NPIDB team 2003 - 2021

text