Pfam domain
Pfam family: Integrase_H2C2 (PF17921.3)
Uniprot AC: P14350
RecName: Pro-Pol polyprotein
Begin-End: 800-856
Organism: Human spumaretrovirus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
PPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNAS
Structures of the domain P14350 800-856
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2w X-ray 3.2 A 49-105  H-Bb H-Mj L-Bb 
3os0 X-ray 2.81 A 49-105  H-Bb H-Mj L-Bb 
3oyi X-ray 2.72 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3l2u X-ray 3.15 A 49-105  H-Bb H-Mj L-Bb 
3oyn X-ray 2.68 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oyd X-ray 2.54 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3l2v X-ray 3.2 A 49-105  H-Bb H-Mj L-Bb 
3oym X-ray 2.02 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3os2 X-ray 3.32 A 49-105  H-Bb H-Mj L-Bb 
3l2q X-ray 3.25 A 49-105  H-Mj 
3os1 X-ray 2.97 A 49-105  H-Bb H-Mj L-Bb 
5no1 X-ray 2.6 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3l2r X-ray 2.88 A 49-105  H-Bb H-Mj L-Bb 
3oyc X-ray 2.66 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oyj X-ray 2.68 A 49-105  H-Bb H-Mj L-Bb 
3oyb X-ray 2.54 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oyh X-ray 2.74 A 49-105  H-Bb H-Mj L-Bb 
3oye X-ray 2.74 A 49-105  H-Bb H-Mj L-Bb 
3oyl X-ray 2.54 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oyg X-ray 2.56 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oyk X-ray 2.72 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oyf X-ray 2.51 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oya X-ray 2.65 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3s3n X-ray 2.49 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3s3o X-ray 2.55 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3s3m X-ray 2.49 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4e7j X-ray 3.15 A 49-105  H-Bb H-Mj L-Bb 
4e7h X-ray 2.57 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4e7i X-ray 2.53 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4e7k X-ray 3.02 A 49-105  H-Bb H-Mj L-Bb 
4e7l X-ray 3 A 49-105  H-Bb H-Mj L-Bb 
4bdy X-ray 2.52 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4be0 X-ray 2.68 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4be1 X-ray 2.71 A 49-105  H-Bb H-Mj L-Bb 
4bdz X-ray 2.85 A 49-105  H-Bb H-Mj L-Bb 
4be2 X-ray 2.38 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4ikf X-ray 3.4 A 49-105  H-Bb H-Mj L-Bb 
5mma X-ray 2.55 A 49-105  H-Bb H-Mj L-Bb L-Mn 
5fro X-ray 2.67 A 49-105  H-Bb H-Mj L-Bb L-Mn 
3oy9 X-ray 2.55 A 49-105  H-Bb H-Mj L-Bb L-Mn 
5uoq X-ray 2.61 A 49-105  H-Bb H-Mj L-Bb L-Mn 
5uop X-ray 2.85 A 49-105  H-Bb H-Mj L-Bb 
6rny X-ray 3.9 K 49-105 None
6rny X-ray 3.9 O 49-105  H-Bb 
5frm X-ray 2.58 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4ztj X-ray 2.67 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4ztf X-ray 2.7 A 49-105  H-Bb H-Mj L-Bb L-Mn 
4bac X-ray 3.26 A 49-105  H-Bb H-Mj L-Bb 
5frn X-ray 2.85 A 49-105  H-Bb H-Mj L-Bb 
5mmb X-ray 2.77 A 49-105  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text