Pfam domain
Pfam family: rve (PF00665.28)
Uniprot AC: P14350
RecName: Pro-Pol polyprotein
Begin-End: 869-965
Organism: Human spumaretrovirus
Interaction Mode:   

Sequence:
PQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIA
IPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHP
Structures of the domain P14350 869-965
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2w X-ray 3.2 B 118-214 None
3l2w X-ray 3.2 A 118-214 None
3os0 X-ray 2.81 A 118-214 None
3os0 X-ray 2.81 B 118-214 None
3oyi X-ray 2.72 A 118-214 None
3oyi X-ray 2.72 B 118-218 None
3l2u X-ray 3.15 A 118-214 None
3l2u X-ray 3.15 B 118-214 None
3oyn X-ray 2.68 A 118-214 None
3oyn X-ray 2.68 B 118-214 None
3oyd X-ray 2.54 A 118-214 None
3oyd X-ray 2.54 B 118-214 None
3l2v X-ray 3.2 B 118-214 None
3l2v X-ray 3.2 A 118-214 None
3oym X-ray 2.02 A 118-214 None
3oym X-ray 2.02 B 118-214 None
3os2 X-ray 3.32 B 118-214 None
3os2 X-ray 3.32 A 118-214 None
3l2q X-ray 3.25 B 118-214 None
3l2q X-ray 3.25 A 118-214 None
3os1 X-ray 2.97 A 118-214 None
3os1 X-ray 2.97 B 118-214 None
5no1 X-ray 2.6 B 118-214 None
5no1 X-ray 2.6 A 118-214 None
3l2r X-ray 2.88 A 118-214 None
3l2r X-ray 2.88 B 118-214 None
3oyc X-ray 2.66 A 118-214 None
3oyc X-ray 2.66 B 118-214 None
3oyj X-ray 2.68 A 118-214 None
3oyj X-ray 2.68 B 118-218 None
3oyb X-ray 2.54 A 118-214 None
3oyb X-ray 2.54 B 118-214 None
3oyh X-ray 2.74 A 118-214 None
3oyh X-ray 2.74 B 118-214 None
3oye X-ray 2.74 A 118-214 None
3oye X-ray 2.74 B 118-214 None
3oyl X-ray 2.54 A 118-214 None
3oyl X-ray 2.54 B 118-218 None
3oyg X-ray 2.56 B 118-214 None
3oyg X-ray 2.56 A 118-214 None
3oyk X-ray 2.72 B 118-218 None
3oyk X-ray 2.72 A 118-214 None
3oyf X-ray 2.51 B 118-214 None
3oyf X-ray 2.51 A 118-214 None
3oya X-ray 2.65 A 118-214 None
3oya X-ray 2.65 B 118-214 None
3s3n X-ray 2.49 B 118-217 None
3s3n X-ray 2.49 A 118-214 None
3s3o X-ray 2.55 B 118-214 None
3s3o X-ray 2.55 A 118-214 None
3s3m X-ray 2.49 B 118-214 None
3s3m X-ray 2.49 A 118-214 None
4e7j X-ray 3.15 B 118-214 None
4e7j X-ray 3.15 A 118-214 None
4e7h X-ray 2.57 A 118-214 None
4e7h X-ray 2.57 B 118-214 None
4e7i X-ray 2.53 B 118-214 None
4e7i X-ray 2.53 A 118-214 None
4e7k X-ray 3.02 B 118-214 None
4e7k X-ray 3.02 A 118-214 None
4e7l X-ray 3 B 118-214 None
4e7l X-ray 3 A 118-214 None
4bdy X-ray 2.52 B 118-214 None
4bdy X-ray 2.52 A 118-214 None
4be0 X-ray 2.68 B 118-214 None
4be0 X-ray 2.68 A 118-214 None
4be1 X-ray 2.71 A 118-214 None
4be1 X-ray 2.71 B 118-214 None
4bdz X-ray 2.85 B 118-214 None
4bdz X-ray 2.85 A 118-214 None
4be2 X-ray 2.38 A 118-214 None
4be2 X-ray 2.38 B 118-214 None
4ikf X-ray 3.4 B 118-214 None
4ikf X-ray 3.4 A 118-214 None
5mma X-ray 2.55 A 118-214 None
5mma X-ray 2.55 B 118-214 None
5fro X-ray 2.67 A 118-214 None
5fro X-ray 2.67 B 118-214 None
3oy9 X-ray 2.55 A 118-214 None
3oy9 X-ray 2.55 B 118-214 None
5uoq X-ray 2.61 B 118-214 None
5uoq X-ray 2.61 A 118-214 None
5uop X-ray 2.85 B 118-214 None
5uop X-ray 2.85 A 118-214 None
6rny X-ray 3.9 K 118-214 None
6rny X-ray 3.9 O 118-214 None
5frm X-ray 2.58 B 118-214 None
5frm X-ray 2.58 A 118-214 None
4ztj X-ray 2.67 A 118-214 None
4ztj X-ray 2.67 B 118-214 None
4ztf X-ray 2.7 A 118-214 None
4ztf X-ray 2.7 B 118-214 None
4bac X-ray 3.26 A 118-214  H-Bb S-Bb L-Bb L-Mj L-Mn 
4bac X-ray 3.26 B 118-214 None
5frn X-ray 2.85 B 118-214 None
5frn X-ray 2.85 A 118-214 None
5mmb X-ray 2.77 B 118-214 None
5mmb X-ray 2.77 A 118-214 None


© NPIDB team 2003 - 2021

text