Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P15806
RecName: Transcription factor E2-alpha
Begin-End: 547-600
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLE
Structures of the domain P15806 547-600
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ql2 X-ray 2.5 A 543-596  H-Bb H-Mj L-Bb 
2ql2 X-ray 2.5 C 543-596  H-Bb H-Mj 
2ql2 X-ray 2.5 A 543-596  H-Bb H-Mj L-Bb 
2ql2 X-ray 2.5 C 543-596  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text