Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P15884
RecName: Transcription factor 4
Begin-End: 565-618
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLE
Structures of the domain P15884 565-618
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6od4 X-ray 1.7 G 573-622 None
6od4 X-ray 1.7 B 569-622  H-Bb H-Mj 
6od4 X-ray 1.7 A 569-622  H-Bb H-Mj 
6od5 X-ray 2.05 B 569-622  H-Bb H-Mj 
6od5 X-ray 2.05 A 569-622  H-Bb H-Mj 
6od5 X-ray 2.05 D 569-622  H-Bb H-Mj 
6od5 X-ray 2.05 C 569-622  H-Bb H-Mj 
6od3 X-ray 1.49 A 569-622  H-Bb H-Mj 
6od3 X-ray 1.49 B 569-622  H-Bb H-Mj L-Bb 
6od3 X-ray 1.49 F 569-622  H-Bb H-Mj 
6od3 X-ray 1.49 E 569-622  H-Bb H-Mj 
6od3 X-ray 1.49 H 569-622 None
6od3 X-ray 1.49 I 570-622 None


© NPIDB team 2003 - 2021

text