Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P15884
RecName: Transcription factor 4
Begin-End: 570-618
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLE
Structures of the domain P15884 570-618
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6od4 X-ray 1.7 H 574-622 None
6od3 X-ray 1.49 G 574-622 None
6od3 X-ray 1.49 J 577-622 None


© NPIDB team 2003 - 2021

text