Pfam domain
Pfam family: RAG1 (PF12940.9)
Uniprot AC: P15919
RecName: V(D)J recombination-activating protein 1
Begin-End: 396-1007
Organism: Mus musculus
Interaction Mode:   

Sequence:
LLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLALRARNEHRQADELEAIM
QGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYH
PFEWQPPLKNVSSRTDVGIIDGLSGLASSVDEYPVDTIAKRFRYDSALVSALMDMEEDIL
EGMRSQDLDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMRITIEHGS
QNVKVFEEPKPNSELCCKPLCLMLADESDHETLTAILSPLIAEREAMKSSELTLEMGGIP
RTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDTTRLEASQNLVFHSITRSHAENLQ
RYEVWRSNPYHESVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEV
YKHPNASKEERKRWQATLDKHLRKRMNLKPIMRMNGNFARKLMTQETVDAVCELIPSEER
HEALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNY
FHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT
SKYLQKFMNAHN
Structures of the domain P15919 396-1007
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cik X-ray 3.15 C 396-1007  H-Bb H-Mj L-Bb L-Mn 
6cik X-ray 3.15 A 395-1007  H-Bb H-Mj L-Bb L-Mn 
6oep X-ray 3.7 C 395-1008  H-Bb H-Mj L-Bb L-Mn 
6oem X-ray 3.6 A 400-1008  H-Bb H-Mj L-Bb L-Mn 
6oem X-ray 3.6 C 395-1008  H-Bb H-Mj L-Bb L-Mn 
6oeo X-ray 3.69 C 393-1008  H-Bb H-Mj L-Bb L-Mn 
6oeq X-ray 4.3 A 400-1008  H-Bb H-Mj L-Bb L-Mn 
6oeq X-ray 4.3 C 393-1008  H-Bb H-Mj L-Bb L-Mj 
6cil X-ray 4.15 C 397-1007  H-Bb H-Mj L-Bb L-Mn 
6oer X-ray 3.29 C 393-1008  H-Bb H-Mj L-Bb L-Mn 
6cim X-ray 3.6 A 395-1007  H-Bb H-Mj L-Bb 
6cim X-ray 3.6 C 396-1007  H-Bb H-Mj L-Bb L-Mn 
6oen X-ray 4.3 C 395-1008  H-Bb H-Mj L-Bb L-Mn 
6oen X-ray 4.3 A 400-1008  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text