Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P15923
RecName: Transcription factor E2-alpha
Begin-End: 550-603
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLE
Structures of the domain P15923 550-603
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ypb X-ray 2.87 B 547-600  H-Bb H-Mj 
2ypa X-ray 2.8 B 547-600  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text