Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P16104
RecName: Histone H2AX
Begin-End: 14-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARD
NKKTRIIPRHLQLAIRND
Structures of the domain P16104 14-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6k1k X-ray 2.2 G 9-90 None
6k1k X-ray 2.2 C 14-90 None
6k1j X-ray 2.85 G 13-90 None
6k1j X-ray 2.85 C 13-90 None
6k1i X-ray 2.75 G 13-90 None
6k1i X-ray 2.75 C 13-90 None


© NPIDB team 2003 - 2021

text