Pfam domain
Pfam family: RHD_dimer (PF16179.7)
Uniprot AC: P16236
RecName: Proto-oncogene c-Rel
Begin-End: 186-281
Organism: Gallus gallus
Interaction Mode:   

Sequence:
RICRVNKNCGSVKGGDEIFILCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIVFRT
PPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPD
Structures of the domain P16236 186-281
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gji X-ray 2.85 B 186-281  L-Bb 
1gji X-ray 2.85 A 186-281  L-Bb 


© NPIDB team 2003 - 2021

text