Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P17542
RecName: T-cell acute lymphocytic leukemia protein 1
Begin-End: 188-240
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
Structures of the domain P17542 188-240
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ypb X-ray 2.87 A 188-240  H-Bb H-Mj 
2ypa X-ray 2.8 A 188-240  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text