Pfam domain
Pfam family: RNA_pol_3_Rpc31 (PF11705.10)
Uniprot AC: P17890
RecName: DNA-directed RNA polymerase III subunit RPC7
Begin-End: 35-122
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EFPSIPLPINGPITNKERSLAVKYINFGKTVKDGPFYTGSMSLIIDQQENSKSGKRKPNI
ILDEDDTNDGIERYSDKYLKKRKIGISI
Structures of the domain P17890 35-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 Q 35-122 None
6eu1 X-ray 3.4 Q 34-122 None


© NPIDB team 2003 - 2021

text