Pfam domain
Pfam family: RNA_pol_3_Rpc31 (PF11705.10)
Uniprot AC: P17890
RecName: DNA-directed RNA polymerase III subunit RPC7
Begin-End: 36-89
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FPSIPLPINGPITNKERSLAVKYINFGKTVKDGPFYTGSMSLIIDQQENSKSGK
Structures of the domain P17890 36-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cnc X-ray 4.1 Q 36-70 None
6cnf X-ray 4.5 Q 36-70 None
6cnb X-ray 4.1 Q 36-70 None
6cnd X-ray 4.8 Q 36-70 None


© NPIDB team 2003 - 2021

text