Pfam domain
Pfam family: HBB (PF06777.13)
Uniprot AC: P18074
RecName: General transcription and DNA repair factor IIH helicase subunit XPD
Begin-End: 269-413
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEH
FLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEI
TDLADFSPLTLLANFATLVSTYAKG
Structures of the domain P18074 269-413
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o9l X-ray 7.2 0 269-413 None
6ro4 X-ray 3.5 B 263-413 None
5iy9 X-ray 6.3 W 269-395 None
5ivw X-ray 10 W 269-395 None
5iy6 X-ray 7.2 W 269-395 None
5iy8 X-ray 7.9 W 269-395 None
5iy7 X-ray 8.6 W 269-395 None


© NPIDB team 2003 - 2021

text