Pfam domain
Pfam family: Helicase_C_2 (PF13307.8)
Uniprot AC: P18074
RecName: General transcription and DNA repair factor IIH helicase subunit XPD
Begin-End: 524-700
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEK
YQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQ
FQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
Structures of the domain P18074 524-700
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o9l X-ray 7.2 0 524-700 None
6ro4 X-ray 3.5 B 524-700 None
5iy9 X-ray 6.3 W 524-700 None
5ivw X-ray 10 W 524-700 None
5iy6 X-ray 7.2 W 524-700 None
5iy8 X-ray 7.9 W 524-700 None
5iy7 X-ray 8.6 W 524-700 None


© NPIDB team 2003 - 2021

text