Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P18113
RecName: Thyroid hormone receptor beta
Begin-End: 105-176
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
ELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQEC
RFKKCIYVGMAT
Structures of the domain P18113 105-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3m9e X-ray 2.41 B 104-175  H-Bb H-Mj S-Bb L-Bb L-Mj 
3m9e X-ray 2.41 A 104-175  H-Bb H-Mj S-Bb L-Bb L-Mj 
3m9e X-ray 2.41 F 104-175  H-Bb H-Mj S-Bb S-Mj L-Bb 
3m9e X-ray 2.41 E 104-175  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text