Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P19793
RecName: Retinoic acid receptor RXR-alpha
Begin-End: 133-202
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
HICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRY
QKCLAMGMKR
Structures of the domain P19793 133-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nll X-ray 1.9 A 135-200  H-Bb H-Mj S-Bb L-Bb 
1by4 X-ray 2.1 A 1133-1202  H-Bb H-Mj L-Bb 
1by4 X-ray 2.1 B 1233-1302  H-Bb H-Mj S-Bb L-Bb 
1by4 X-ray 2.1 D 2233-2302  H-Bb H-Mj S-Bb L-Bb 
1by4 X-ray 2.1 C 2133-2202  H-Bb H-Mj S-Bb L-Bb 
3dzy X-ray 3.1 A 133-202  H-Bb H-Mj S-Mj L-Bb 
1dsz X-ray 1.7 B 1233-1302  H-Bb H-Mj S-Bb S-Mj L-Bb 
1r0n X-ray 2.6 A 99-168  H-Bb H-Mj S-Bb L-Bb L-Mj 
1ynw X-ray 3 B 234-302  H-Bb H-Mj S-Mj L-Bb 
3dzu X-ray 3.2 A 133-202  H-Bb H-Mj S-Bb L-Bb 
6fbr X-ray 2.1 A 133-202  H-Bb H-Mj S-Bb L-Bb 
6fbr X-ray 2.1 B 133-202  H-Bb H-Mj S-Bb L-Bb 
5uan X-ray 3.51 A 133-202  H-Bb H-Mj S-Bb L-Bb 
4nqa X-ray 3.1 H 133-202  H-Bb H-Mj L-Bb 
4nqa X-ray 3.1 A 133-202  H-Bb H-Mj L-Bb 
4cn3 X-ray 2.35 D 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn3 X-ray 2.35 A 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn3 X-ray 2.35 C 133-202  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4cn3 X-ray 2.35 B 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn7 X-ray 2.34 B 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn7 X-ray 2.34 A 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn7 X-ray 2.34 F 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn7 X-ray 2.34 E 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn5 X-ray 2 B 133-202  H-Bb H-Mj S-Bb L-Bb 
4cn5 X-ray 2 A 133-202  H-Bb H-Mj S-Bb S-Mj L-Bb 
4cn2 X-ray 2.07 D 133-202  H-Bb H-Mj L-Bb 
4cn2 X-ray 2.07 C 133-202  H-Bb H-Mj S-Bb S-Mj L-Bb 
3e00 X-ray 3.1 A 133-202  H-Bb H-Mj L-Bb 
6fbq X-ray 1.6 A 133-202  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
6fbq X-ray 1.6 B 133-202  H-Bb H-Mj S-Bb L-Bb 
6xwg X-ray 2.4 C 133-202  H-Bb H-Mj S-Bb S-Mj L-Bb 
6xwh X-ray 2.1 C 133-202  H-Bb H-Mj S-Bb L-Bb 
6xwh X-ray 2.1 D 133-202  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text