Pfam domain
Pfam family: RHD_dimer (PF16179.7)
Uniprot AC: P19838
RecName: Nuclear factor NF-kappa-B p105 subunit
Begin-End: 251-352
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
KIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFA
IVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE
Structures of the domain P19838 251-352
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1svc X-ray 2.6 P 252-353 None
2o61 X-ray 2.8 B 249-350  L-Bb 
3gut X-ray 3.59 H 549-650  L-Bb 
3gut X-ray 3.59 F 549-650  L-Bb 
3gut X-ray 3.59 D 549-650  L-Bb 
3gut X-ray 3.59 B 549-650  L-Bb 


© NPIDB team 2003 - 2021

text