Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P20153
RecName: Protein ultraspiracle
Begin-End: 102-171
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRY
QKCLTCGMKR
Structures of the domain P20153 102-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r0o X-ray 2.24 A 5-74  H-Bb H-Mj L-Bb L-Mj 
2han X-ray 1.95 A 5-74  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text