Pfam domain
Pfam family: TBP (PF00352.23)
Uniprot AC: P20226
RecName: TATA-box-binding protein
Begin-End: 162-244
Organism: Homo sapiens
Interaction Mode:  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 

Sequence:
VPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVC
TGAKSEEQSRLAARKYARVVQKL
Structures of the domain P20226 162-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1tgh X-ray 2.9 A 158-240  S-Bb S-Mn L-Bb L-Mj L-Mn 
5iyc X-ray 3.9 P 162-244  S-Bb S-Mn L-Bb L-Mn 
6o9l X-ray 7.2 P 162-244  S-Bb S-Mn L-Bb L-Mn 
1nvp X-ray 2.1 A 162-244  S-Bb S-Mn L-Bb L-Mn 
1c9b X-ray 2.65 B 162-244  S-Bb S-Mn L-Bb L-Mn 
1c9b X-ray 2.65 R 162-244  S-Bb S-Mn L-Bb L-Mn 
1c9b X-ray 2.65 N 162-244  S-Bb S-Mn L-Bb L-Mn 
1c9b X-ray 2.65 J 162-244  S-Bb S-Mn L-Bb L-Mn 
1c9b X-ray 2.65 F 162-244  S-Bb S-Mn L-Bb L-Mn 
4roc X-ray 1.9 B 162-244  S-Bb S-Mj S-Mn L-Bb L-Mn 
4rod X-ray 2.7 B 162-244  S-Bb S-Mn L-Bb L-Mn 
4roe X-ray 2.2 B 162-244  S-Bb S-Mn L-Bb L-Mn 
5iy9 X-ray 6.3 P 162-244  S-Mn L-Mj 
5iyb X-ray 3.9 P 162-244  S-Bb S-Mn L-Bb L-Mn 
5iy6 X-ray 7.2 P 162-244  S-Bb S-Mn L-Bb 
5fur X-ray 8.5 A 162-244  S-Bb S-Mn L-Bb L-Mn 
5n9g X-ray 2.7 G 162-244 None
5n9g X-ray 2.7 B 162-244 None
6mzm X-ray 7.5 T 162-244  S-Bb S-Mn L-Bb L-Mj L-Mn 
5iya X-ray 5.4 P 162-244  S-Bb S-Mn L-Bb L-Mn 
1jfi X-ray 2.62 C 362-444  S-Bb S-Mn L-Bb L-Mn 
5iy8 X-ray 7.9 P 162-244  S-Bb S-Mn L-Bb L-Mn 
5iyd X-ray 3.9 P 162-244  S-Mn 
1cdw X-ray 1.9 A 158-240  S-Bb S-Mn L-Bb L-Mn 
5iy7 X-ray 8.6 P 162-244  S-Bb S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text