Pfam domain
Pfam family: Pou (PF00157.19)
Uniprot AC: P20263
RecName: POU domain, class 5, transcription factor 1
Begin-End: 134-205
Organism: Mus musculus
Interaction Mode:   

Sequence:
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKL
RPLLEKWVEEAD
Structures of the domain P20263 134-205
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ht5 X-ray 3.45 E 136-207  H-Bb H-Mj L-Bb 
3l1p X-ray 2.8 B 4-75  H-Bb H-Mj L-Bb L-Mj 
3l1p X-ray 2.8 A 4-75  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text