Pfam domain
Pfam family: Resolvase (PF00239.23)
Uniprot AC: P20384
RecName: Putative transposon Tn552 DNA-invertase bin3
Begin-End: 2-145
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
IIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVRMGDRFIV
ESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVS
EQERNESKRRQAQGIQVAKEKGVY
Structures of the domain P20384 2-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2r0q X-ray 3.2 F 2-145 None
2r0q X-ray 3.2 E 2-145  H-Mn L-Bb 
2r0q X-ray 3.2 D 2-145 None
2r0q X-ray 3.2 C 2-145  H-Mn 


© NPIDB team 2003 - 2021

text