Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: P20429
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 26-221
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
EPLERGYGTTLGNSLRRILLSSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKL
ALKIYSDEEKTLEIDVQGEGTVTAADITHDSDVEILNPDLHIATLGENASFRVRLTAQRG
RGYTPADANKRDDQPIGVIPIDSIYTPVSRVSYQVENTRVGQVANYDKLTLDVWTDGSTG
PKEAIALGSKILTEHL
Structures of the domain P20429 26-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 B 26-221 None
6wvj X-ray 3.36 A 26-221 None
7ckq X-ray 4.4 B 26-221 None
7ckq X-ray 4.4 A 26-221 None


© NPIDB team 2003 - 2021

text