Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: P20429
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 53-171
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
VTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGEGTVTAADI
THDSDVEILNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGVIPIDSIYT
Structures of the domain P20429 53-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 B 53-179 None
6wvj X-ray 3.36 A 53-179 None
7ckq X-ray 4.4 B 53-179 None
7ckq X-ray 4.4 A 53-179 None


© NPIDB team 2003 - 2021

text