Pfam domain
Pfam family: RNA_pol_Rpb5_C (PF01191.21)
Uniprot AC: P20434
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC1
Begin-End: 142-214
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRK
SETSGRYASYRIC
Structures of the domain P20434 142-214
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nvx X-ray 3.6 E 142-214 None
5m5x X-ray 4 E 142-214 None
3hox X-ray 3.65 E 142-214 None
6tps X-ray 3.54 E 142-214 None
2vum X-ray 3.4 E 142-214 None
6bm2 X-ray 3.4 E 142-214 None
3hoy X-ray 3.4 E 142-214 None
3hoz X-ray 3.65 E 142-214 None
4bxx X-ray 3.28 E 142-214 None
4a3k X-ray 3.5 E 142-214 None
1y1w X-ray 4 E 142-214 None
5m64 X-ray 4.6 E 142-214 None
3s15 X-ray 3.3 E 142-214 None
6uq1 X-ray 3.6 E 142-214 None
2ja5 X-ray 3.8 E 142-214 None
2ja6 X-ray 4 E 142-214 None
3s1r X-ray 3.2 E 142-214 None
6blo X-ray 3.4 E 142-214 None
3gto X-ray 4 E 142-214 None
2nvq X-ray 2.9 E 142-214 None
2ja8 X-ray 3.8 E 142-214 None
1sfo X-ray 3.61 E 142-214 None
1y1y X-ray 4 E 142-214 None
3m4o X-ray 3.57 E 142-214 None
4a93 X-ray 3.4 E 142-214 None
5w5y X-ray 3.8 E 142-214 None
1r9s X-ray 4.25 E 142-214 None
6ruo X-ray 3.5 E 142-214 None
2r7z X-ray 3.8 E 142-214 None
2e2i X-ray 3.41 E 142-214 None
2b63 X-ray 3.8 E 142-214 None
3po2 X-ray 3.3 E 142-214 None
1r9t X-ray 3.5 E 142-214 None
6rrd X-ray 3.1 E 142-214 None
2e2h X-ray 3.95 E 142-214 None
1y77 X-ray 4.5 E 142-214 None
4a3m X-ray 3.9 E 142-214 None
3hou X-ray 3.2 E 142-214 None
3hou X-ray 3.2 Q 142-214 None
3hov X-ray 3.5 E 142-214 None
3m3y X-ray 3.18 E 142-214 None
2nvt X-ray 3.36 E 142-214 None
6blp X-ray 3.2 E 142-214 None
3i4n X-ray 3.9 E 142-214 None
3how X-ray 3.6 E 142-214 None
3gtk X-ray 3.8 E 142-214 None
6eu0 X-ray 4 E 142-214 None
3s1q X-ray 3.3 E 142-214 None
3s16 X-ray 3.24 E 142-214 None
4a3j X-ray 3.7 E 142-214 None
4a3b X-ray 3.5 E 142-214 None
4a3c X-ray 3.5 E 142-214 None
4a3d X-ray 3.4 E 142-214 None
4a3g X-ray 3.5 E 142-214 None
6rql X-ray 2.9 E 142-214 None
4a3f X-ray 3.5 E 142-214 None
4a3l X-ray 3.5 E 142-214 None
6uq3 X-ray 3.47 E 142-214 None
5n61 X-ray 3.4 E 142-214 None
3i4m X-ray 3.7 E 142-214 None
2ja7 X-ray 3.8 E 142-214 None
2ja7 X-ray 3.8 Q 142-214 None
4x67 X-ray 4.1 E 142-214 None
4bbs X-ray 3.6 E 142-214 None
5m5w X-ray 3.8 E 142-214 None
5m5y X-ray 4 E 142-214 None
4by7 X-ray 3.15 E 142-214 None
4by1 X-ray 3.6 E 142-214 None
1i6h X-ray 3.3 E 142-214 None
3gtj X-ray 3.42 E 142-214 None
5c44 X-ray 3.95 E 142-214 None
5fmf X-ray 6 E 142-214 None
5m3f X-ray 3.8 E 142-214 None
3gtp X-ray 3.9 E 142-214 None
5fj8 X-ray 3.9 E 142-214 None
4v1o X-ray 9.7 E 142-214 None
4v1m X-ray 6.6 E 142-214 None
5w4u X-ray 3.6 E 142-214 None
5fyw X-ray 4.35 E 142-214 None
4a3i X-ray 3.8 E 142-214 None
4v1n X-ray 7.8 E 142-214 None
5c4x X-ray 4 E 142-214 None
3rzo X-ray 3 E 142-214 None
6bqf X-ray 3.35 E 142-214 None
2yu9 X-ray 3.4 E 142-214 None
6gyk X-ray 5.1 E 142-214 None
5c4j X-ray 4 E 142-214 None
6cnc X-ray 4.1 E 142-214 None
3gtm X-ray 3.8 E 142-214 None
3gtq X-ray 3.8 E 142-214 None
5w51 X-ray 3.4 E 142-214 None
6h67 X-ray 3.6 E 142-214 None
3gtg X-ray 3.78 E 142-214 None
6i84 X-ray 4.4 E 142-214 None
5w66 X-ray 3.9 E 142-214 None
6upz X-ray 3.1 E 142-214 None
3s2d X-ray 3.2 E 142-214 None
3s1n X-ray 3.1 E 142-214 None
3rzd X-ray 3.3 E 142-214 None
4a3e X-ray 3.4 E 142-214 None
3s14 X-ray 2.85 E 142-214 None
5w65 X-ray 4.3 E 142-214 None
6f44 X-ray 4.2 E 142-214 None
3s1m X-ray 3.13 E 142-214 None
2r93 X-ray 4 E 142-214 None
3s17 X-ray 3.2 E 142-214 None
3h3v X-ray 4 F 142-214 None
5c4a X-ray 4.2 E 142-214 None
3po3 X-ray 3.3 E 142-214 None
2r92 X-ray 3.8 E 142-214 None
3s2h X-ray 3.3 E 142-214 None
5vvs X-ray 6.4 E 142-214 None
6f41 X-ray 4.3 E 142-214 None
6o6c X-ray 3.1 D 142-214 None
5oqj X-ray 4.7 E 142-214 None
3gtl X-ray 3.38 E 142-214 None
4y7n X-ray 3.3 E 142-214 None
5oa1 X-ray 4.4 E 142-214 None
5fz5 X-ray 8.8 E 142-214 None
6hko X-ray 3.42 E 142-214 None
6uq2 X-ray 3.2 E 142-214 None
4x6a X-ray 3.96 E 142-214 None
5oqm X-ray 5.8 E 142-214 None
4y52 X-ray 3.5 E 142-214 None
6cnf X-ray 4.5 E 142-214 None
6gym X-ray 6.7 E 142-214 None
6rqt X-ray 4 E 142-214 None
6eu1 X-ray 3.4 E 142-214 None
6bm4 X-ray 2.95 E 142-214 None
2nvz X-ray 4.3 E 142-214 None
6gyl X-ray 4.8 E 142-214 None
6h68 X-ray 4.6 E 142-214 None
5c3e X-ray 3.7 E 142-214 None
5ot2 X-ray 3.2 E 142-214 None
5sva X-ray 15.3 E 142-214 None
2e2j X-ray 3.5 E 142-214 None
6rqh X-ray 3.7 E 142-214 None
6upx X-ray 3.4 E 142-214 None
6f40 X-ray 3.7 E 142-214 None
6rwe X-ray 3 E 142-214 None
6hlq X-ray 3.18 E 142-214 None
5vvr X-ray 5.8 E 142-214 None
6rui X-ray 2.7 E 142-214 None
6hlr X-ray 3.18 E 142-214 None
5w64 X-ray 4.2 E 142-214 None
6cnb X-ray 4.1 E 142-214 None
6f42 X-ray 5.5 E 142-214 None
6cnd X-ray 4.8 E 142-214 None
6uq0 X-ray 3.56 E 142-214 None
6upy X-ray 3.4 E 142-214 None


© NPIDB team 2003 - 2021

text